PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID orange1.1g001728m
Common NameCISIN_1g001728mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family ARF
Protein Properties Length: 1021aa    MW: 114037 Da    PI: 7.3483
Description ARF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
orange1.1g001728mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B372.45.6e-23126227199
                        EEEE-..-HHHHTT-EE--HHH.HTT.......---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE- CS
                 B3   1 ffkvltpsdvlksgrlvlpkkfaeeh.......ggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkld 85 
                        f+k+lt sd++++g +++p++ ae++       + +++  ++++ +d++  +W++++iyr++++r++lt+GW+ Fv+ ++L +gD+v+F   
  orange1.1g001728m 126 FCKTLTASDTSTHGGFSVPRRAAEKIfppldysM-QPPA-QEIVARDLHDTTWTFRHIYRGQPKRHLLTTGWSVFVSTKRLFAGDSVLFI-- 213
                        99*****************************954.5444.38************************************************.. PP

                        SSSEE..EEEEE-S CS
                 B3  86 grsefelvvkvfrk 99 
                        ++++ +l+++++r+
  orange1.1g001728m 214 RDEKSQLLLGIRRA 227
                        45677789999997 PP

2Auxin_resp123.51.4e-40252334183
         Auxin_resp   1 aahaastksvFevvYnPrastseFvvkvekvekalkvkvsvGmRfkmafetedsserrlsGtvvgvsdldpvrWpnSkWrsLk 83 
                        aahaa+++s+F+++YnPras+seFv++++k++ka++++vs+GmRf+m+fete+s  rr++Gt++++sdldp+rW+nS+Wr+L+
  orange1.1g001728m 252 AAHAAANNSPFTIFYNPRASPSEFVIPLAKYNKAMYTQVSLGMRFRMMFETEESGVRRYMGTITSISDLDPLRWKNSQWRNLQ 334
                        79*******************************************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019361.06E-44116255IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.2E-42118241IPR015300DNA-binding pseudobarrel domain
CDDcd100172.77E-20125226No hitNo description
PfamPF023626.7E-21126227IPR003340B3 DNA binding domain
SMARTSM010193.7E-24126228IPR003340B3 DNA binding domain
PROSITE profilePS5086312.421126228IPR003340B3 DNA binding domain
PfamPF065071.9E-35252334IPR010525Auxin response factor
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009723Biological Processresponse to ethylene
GO:0009734Biological Processauxin-activated signaling pathway
GO:0010311Biological Processlateral root formation
GO:0048366Biological Processleaf development
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 1021 aa     Download sequence    Send to blast
MKPPANGFLP SSAEGERKTI NSELWHACAG PLVSLPPVGS LVVYFPQGHS EQVAASMQKE  60
NDFIPNYPNL PSKLICMLHS VTLHADPETD EVYAQMTLQP VNKYEKEAIL ASDMGLKQNR  120
QPTEFFCKTL TASDTSTHGG FSVPRRAAEK IFPPLDYSMQ PPAQEIVARD LHDTTWTFRH  180
IYRGQPKRHL LTTGWSVFVS TKRLFAGDSV LFIRDEKSQL LLGIRRANRQ QPALSSSVIS  240
SDSMHIGILA AAAHAAANNS PFTIFYNPRA SPSEFVIPLA KYNKAMYTQV SLGMRFRMMF  300
ETEESGVRRY MGTITSISDL DPLRWKNSQW RNLQVGWDES TAGERPSRVS LWETEPVVTP  360
FYICPPPFFR PKFPKQPGMP DDESDIENAF KRAMPWLGDD FGMKDATSSI FPGLSLVQWM  420
SMQQNNQFPA AQSGFFPSMV SSTGLHSNFG TDDPSKLLNF QASALAAPNL QFSKANPQNQ  480
VNQLPQSPIA WTQQQQLQHL LQNPLNQQQQ QHPQLHQQRQ QQQQLLHPQQ SQQQQQQQQN  540
HHHHNQQPPP PPQLQPSPTP PHSQSQSQSP VPQRPQQQPQ QQQQQPQQQI FLPTHVNNGV  600
LVPNANQNVQ QPTVYSQLQQ PQLLTSNTQA PQGILSNNKN SYQLTSLPQD SQFQQQMEQS  660
TGPLQRQQQQ SQLQQSSLQF LQQSLAQRAQ QQPQVQQLAQ QSMSDQQLQS QLQQKLQQQQ  720
QQQLLSPAGS LLQPQLLQQQ LAHQQNQQLS QLPPSQNHQQ QLSNNLSASV LVQPQQLPMN  780
QPQNQNRPLT GTRAHSNHTD GDAPSCSTSP SSNNCQISPS NFLNRNQQGP AMLMGDSVVE  840
PSSNLVQELH SKSDARIKHE LPISKGPEHL KYNGSMTDQV EASSSGTSYC LDPGNIQQNF  900
SLPTYCLDGD TQSHPRNSLP FVANIDGMAP DTLLSRGYDS QKDLHNLLSN YGGTPRDIET  960
ELSTAAISSQ SFAVPNIPFK PACSNEVGIN EAGVLGNGLW ANQTQRMRTF TKVCYAIYSL  1020
*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4ldu_A1e-1741535545388Auxin response factor 5
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtAuxin response factors (ARFs) are transcriptional factors that binds specifically to the DNA sequence 5'-TGTCTC-3' found in the auxin-responsive promoter elements (AuxREs). {ECO:0000256|RuleBase:RU004561}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006452860.10.0hypothetical protein CICLE_v10007286mg
TrEMBLA0A067G2H00.0A0A067G2H0_CITSI; Auxin response factor
STRINGPOPTR_0006s14070.10.0(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM26292665
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G19220.10.0auxin response factor 19